PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa007322
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 326aa    MW: 35021.1 Da    PI: 10.2787
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58683111PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-44148PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.6e-14106150347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
        Lsa007322 106 PWTEEEHRLFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 150
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.31499155IPR017930Myb domain
SuperFamilySSF466894.71E-17101155IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-17102153IPR006447Myb domain, plants
SMARTSM007172.2E-10103153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-11105150IPR009057Homeodomain-like
PfamPF002493.3E-11106150IPR001005SANT/Myb domain
CDDcd001672.28E-9106151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MAIAPGKYSE SGGTDGGGGG GGIGGAAAFS SAMNSGGIRG KGIMLFGVRL MEGGGGGSSF  60
RKSASMNNLV QYDEQPQESN IDAAGYASDD VVHLSARSRE RKRGVPWTEE EHRLFLVGLQ  120
KVGKGDWRGI SRNFVKTRTP TQVASHAQKY FLRRTNHNRR RRRSSLFDIT TDTCLNSLND  180
DMNQKPPANL KYEPEKYVMT SFPLIPSRLQ LTGGGDHNSI DTLTLGRPST TKQAGNLMPP  240
IPIPPSTKMA KLNLSTPDNY KHHEPPLPLT LNLTTSTSTS TPTTSSDQQS SSPSRHIVVK  300
FQEMSGSFNS SNSSSSSNGD SIISVA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006483741.17e-84PREDICTED: transcription factor MYB1R1 isoform X1
RefseqXP_006438522.19e-84hypothetical protein CICLE_v10032167mg
TrEMBLV4TEN61e-83V4TEN6_9R
STRINGVIT_01s0026g01050.t014e-80(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.23e-61MYB_related family protein